PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB10G26620.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 896aa    MW: 96273.9 Da    PI: 5.6555
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB10G26620.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.61.4e-20139194156
                   TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
      Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                   +++ +++t++q++++e+lF+++++p+ ++r +L+++lgL+ rqVk+WFqNrR+++k
  OB10G26620.1 139 KKRYHRHTAHQIQQMEALFKECPHPDDKQRLKLSQELGLKPRQVKFWFQNRRTQMK 194
                   688999***********************************************998 PP

2START128.48.7e-413545882206
                   HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS..................SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S CS
         START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.................dsgealrasgvvdmvlallveellddkeqWdetla 77 
                   la +aa++l ++  a+ep+Wv+ +    e      v++  e +++                  ++e  r+ +vv+m++ +lv  +ld   +W e ++
  OB10G26620.1 354 LASTAADQLSRMCRAGEPLWVRQRgvasE------VMSVDEHARTfawpvdgekhddaagavARTEGTRDNAVVIMNSINLVDAFLDAD-KWMELFP 443
                   678999******************55541......44444333344455566678888888889999**********************.******* PP

                   ....EEEEEEEECTT........EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE..TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTC CS
         START  78 ....kaetlevissg........galqlmvaelqalsplvp.RdfvfvRyirq.lgagdwvivdvSvdseqkppesssvvRaellpSgiliepksng 160
                       ka t++ i+ g        g+l lm+ae q+lsplvp R++vf Ry+     +g+w+ivd   +  q+   ++s vR++++pSg++i++++ng
  OB10G26620.1 444 sivcKARTIQIINHGaasghlgnGTLLLMQAEVQFLSPLVPaREVVFFRYCVHnADEGSWAIVDFPAEGFQEGLLQASAVRCRRRPSGCIIQDMPNG 540
                   *****************************************************9999*******88887777766********************** PP

                   EEEEEEEE-EE--SSXX..HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
         START 161 hskvtwvehvdlkgrlp..hwllrslvksglaegaktwvatlqrqcek 206
                   +s+v+wveh+++ g     + ++r  v  g+a+ga +wv+ lqrqce+
  OB10G26620.1 541 YSRVVWVEHMEMVGEEKplQPVFRDYVAGGAAFGATRWVSLLQRQCER 588
                   ***********98765449***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.7E-22125190IPR009057Homeodomain-like
SuperFamilySSF466891.3E-19131197IPR009057Homeodomain-like
PROSITE profilePS5007117.022136196IPR001356Homeobox domain
SMARTSM003891.1E-19137200IPR001356Homeobox domain
PfamPF000463.8E-18139194IPR001356Homeobox domain
CDDcd000867.18E-19139197No hitNo description
PROSITE patternPS000270171194IPR017970Homeobox, conserved site
PROSITE profilePS5084844.476344591IPR002913START domain
SuperFamilySSF559613.43E-27347590No hitNo description
CDDcd088755.46E-102348587No hitNo description
SMARTSM002341.5E-20353588IPR002913START domain
PfamPF018526.4E-33354588IPR002913START domain
SuperFamilySSF559611.65E-15613785No hitNo description
SuperFamilySSF559611.65E-15828867No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048497Biological Processmaintenance of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 896 aa     Download sequence    Send to blast
MRRMFGDCQV LSSMAAMAGA SSSADALFTS PLIPNPALAG FMSSSAAMPF HHFSSAATTL  60
IPKEEGLMGG LHVAKDEEMD LEMEMELSGG SGSGHLDSLL SFADVDDDGR EQKPQQSGHD  120
QAADGGQQQA GAAAGGGKKK RYHRHTAHQI QQMEALFKEC PHPDDKQRLK LSQELGLKPR  180
QVKFWFQNRR TQMKAQQDRA DNVILRAENE NLKSDNFRLQ AAIRNVVCPN CGHAAVLGEM  240
TYEEQQLRIE NARLKDELDR LACIATRYGG GRPRLFSPVL STSALSCMSA PPPVLMPPLD  300
LDMNVYSRHF AEQAPVMGGC ADLMPNVVPQ QMDGAAAYIM APMQEQDKQL VLDLASTAAD  360
QLSRMCRAGE PLWVRQRGVA SEVMSVDEHA RTFAWPVDGE KHDDAAGAVA RTEGTRDNAV  420
VIMNSINLVD AFLDADKWME LFPSIVCKAR TIQIINHGAA SGHLGNGTLL LMQAEVQFLS  480
PLVPAREVVF FRYCVHNADE GSWAIVDFPA EGFQEGLLQA SAVRCRRRPS GCIIQDMPNG  540
YSRVVWVEHM EMVGEEKPLQ PVFRDYVAGG AAFGATRWVS LLQRQCERLA SELARNIADL  600
GVIRTPEART NMMKLSQRMI TTFCANISAS GSQSWTALSD STEDTIRVTT RKNTEPGQPS  660
GVILTAVSTS WLPFTHHQVF ELLADEQQRC QLEILSNGGS LHEVAHIANG SHPRNCISLL  720
RINAASNSSQ NVELLLQESS THPDGGSLVV FATVDVDAIQ VTMSGEDPSY IPLLPLGFAI  780
FPATSPSPAA ATISSSTTTT TTTTGNGESS STPPPGNSNA DELPPAANGC LLTVGMQVLA  840
SAVPSAKLNL SSVTAINSHV CNAIHQITAA LKGNAAAAGM SRAAAAAEPA SAGSNQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB1016460.0AB101646.1 Oryza sativa Japonica Group Roc3 mRNA for GL2-type homeodomain protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006662631.20.0PREDICTED: LOW QUALITY PROTEIN: homeobox-leucine zipper protein ROC3-like
SwissprotA2ZAI70.0ROC3_ORYSI; Homeobox-leucine zipper protein ROC3
TrEMBLJ3N5640.0J3N564_ORYBR; Uncharacterized protein
STRINGOB10G26620.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78463441
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G46880.10.0homeobox-7